Questions and answers in category > 587

• My father works abroad, but he promised that hereturn home on my graduation day. a. can b. may c. must d. will​...
  English 2 29.09.2020 04:01
• 6. The music note's placement in the staff shows what kind of melody?​...
  Music 1 29.09.2020 04:01
• examples of paragraph using progressive aspects of verbs,in how politeness and friendship can be observed at all times?​...
  English 1 29.09.2020 04:01
• Ano ang tawag sa grupo ng taludturan sa tula...
  Filipino 1 29.09.2020 04:01
• The line of action is the straight line passing through the point of application and is...
  Science 2 29.09.2020 04:01
• Ano-ano ang mga salik ng pag-usbong ng damdaming nasyonalismong pilipino​...
  Araling Panlipunan 2 29.09.2020 04:01
• Reflection about the bible verse Luke 11:28​...
  Religion 1 29.09.2020 04:01
• Why do you think the Bible was given to us, to what purpose the bible is written?...
  Religion 3 29.09.2020 04:01
• What new realizations do you have about finding the nth term of arithmetic sequence and finding the arithmetic means? How eould you use this in making decisions?...
  Math 2 29.09.2020 04:01
• Why African poetry often recited to a singsong voice ? How it is related to their culture?...
  History 2 29.09.2020 04:01
• What are the concepts of power, politics, justice and governance of Aristotle​...
  English 3 29.09.2020 04:01
• What were your misconceptions about the topic (communication) prior to taking up this lesson? What new or additional learning have you gained from this lesson in terms of skills,...
  World Languages 1 29.09.2020 04:01
• Kawani an9ng ibig sabihin nito...
  Filipino 2 29.09.2020 04:01
• Draw complete Lewis structures for the following condensed structural formulas.(a) CH3(CH2)3CH(CH3)2(b) (CH3)2CHCH2C1(c) CH3CH2COCHCH2​...
  Chemistry 1 29.09.2020 04:01
• Is one form of discourse superior to the others?Or do they complement each other?​...
  Technology and Home Economics 1 29.09.2020 04:01
• there are ( 1 ) __ ways finding general rule or nth term of a given sequence As I go through this topic I learned that different sequence can be solve by/using (2)___,(3)___?​...
  Math 3 29.09.2020 04:01
• It refers how ones membership to a particular race affects....
  English 1 29.09.2020 04:01
• Pa ano po ito find the g.c.f .then,expess each fraction into lowest terms.yan po diko po kase alam☺️​...
  Math 1 29.09.2020 04:01
• How do cells transform, store, and use energy to maintain the survival of organisms?...
  Science 3 29.09.2020 04:01
• Difference between artificial classification and natural classification?​...
  Integrated Science 3 29.09.2020 04:01
• Find the gcf.then express each fraction in to lowest termspa ano po ito ​...
  Math 3 29.09.2020 04:01
• English rap about covid19? ​...
  English 3 29.09.2020 04:01
• Fatima borrowed money from your mother with an interest is 10%.Fatima is a best friend of your mother . What is you stand about this?...
  Math 2 29.09.2020 04:01
• PARTE KANO ti balay da roma?...
  Physical Education 1 29.09.2020 04:01
• An object is thrown upward from the top of a 200 - foot cliff with a velocity of 12 feet per second. The height h in feet of the object after t seconds is h = -16t2 + 12t + 200. Ho...
  Math 1 29.09.2020 04:01
• 1. How are social facts related to social science? 2. How can social studies make an individual a well-informed and a rational citizen? 3. What is the difference between social sc...
  Economics 2 29.09.2020 04:01
• Gumagawa ng isang ekonomikong pagpapasya ang isang tao araw-araw. Bakit mahalagang maunawaan ng isang mag-aaral ang kaalaman sa ekonomiks bilang bahagi ng pamilya?​...
  Araling Panlipunan 1 29.09.2020 04:01
• 6. Ito ang uri ng lahi sa daigdig na may pinakamalaking bilang. A. African-American B. BlackC. Caucasian D. Mo7. Ang kabuhayan ng mga sinaunang tao noong panahong Paleolitiko.A. P...
  Araling Panlipunan 1 29.09.2020 04:01
• What are the components of physical fitness test and its meaning​...
  English 1 29.09.2020 04:01
• Does modern dance catch your attention? Why? ​...
  Physical Education 1 29.09.2020 04:01
• A computer network is composed of two or more computers that shares information and resources.​...
  Computer Science 3 29.09.2020 04:01
• this refers to why and how people eat,which foods they eat ,and with whom they eat as well as the ways people collect store ,use and discard food?​...
  Health 1 29.09.2020 04:01
• What part of the 105kg of potatoes are 5 kg bags?​...
  Math 3 29.09.2020 04:01
• Mabuting kasama ang taong marunong tumanaw ng utang na loob...
  Filipino 2 29.09.2020 04:01
• What is the best movie you have seen ....
  Geography 1 29.09.2020 04:01
• Sino ang namuno sa kilusang itinatag ng mga paring Pilipino,,...
  Araling Panlipunan 3 29.09.2020 04:01
• A literature influenced by the spanish...
  Geography 1 29.09.2020 04:01
• how do you assess this words terrorist pretty gay are you assessments based on unfounded generalization or facts​...
  English 3 29.09.2020 04:01
• 1. What do you think will happen if the lungs and the heart stopped working together?​...
  Science 2 29.09.2020 04:01
• Ano ang gagawin mo kung ikaw ay nakasakay sa jeep at biglang lumindol?​...
  Araling Panlipunan 1 29.09.2020 04:01
• why is it important for the government to upload the rights of the people? is the government the only entity with the responsibility of upholding human rights?​...
  History 1 29.09.2020 04:01
• Express your feelings about your loving country/nation​...
  English 1 29.09.2020 04:01
• LetB =even natural numbers less than 12​...
  Math 2 29.09.2020 04:01
• Computers are the persinal pc is designed for use by an individual at fixed a loaction.​...
  Computer Science 2 29.09.2020 04:01
• How significant is active sports participation in our family/community​...
  Physical Education 1 29.09.2020 04:01
• Pamantayn Kaangkupan ng konsepto Pagkakamalikhain Kompleto ang detalye/nilalaman Ang ideya ay orihinal...
  Technology and Home Economics 1 29.09.2020 04:01
• What is manifested in tagalog​...
  Filipino 2 29.09.2020 04:01
• Verbal StatementSet R is a set whoseelements are evenpositive integersless than ten​...
  Math 2 29.09.2020 04:01
• 1. Bakit mahalaga ang pagtataya ng pagkatotoo at kredibilidad ng bawat dokumento?​...
  History 2 29.09.2020 04:01
• Anthropometric measurement are use to measure the body measurement. Choose among the set of equipment use to measure body mass index.​...
  English 2 29.09.2020 04:01
• Sa panahon ng pandemya, paano napapakita ng mga pilipino ang pagkakaisa?​...
  Edukasyon sa Pagpapakatao 2 29.09.2020 04:01
• Ito ay maliit na hayop na nahahawig sa usa at kabilang sa mga 'endangered species'​...
  Filipino 1 29.09.2020 04:01
• Exercise 2. Google It! Using the internet, look for more information about the given words that reflect culture. Listkey ideas about them and copy your sources of information. If...
  English 1 29.09.2020 04:01
• 5. How will you use communication to contribute something to the world especially during this time of pandemic?​...
  English 3 29.09.2020 04:01
• Pilipinas?Ang pag lobo ng pupulasyon sa​...
  Araling Panlipunan 2 29.09.2020 04:01
• Stors is (X + Who is the other factor?binomial x2 - 64, one of thea, x + 8b. x - 8c. x - 32d. x + 32​...
  Filipino 3 29.09.2020 04:01
• sa limang pangungusap paano mo ilalarawan ang buhay ng mga asyano kung naubos na ang yamang likas na mayroon dito...
  Filipino 1 29.09.2020 04:01
• If (m-t)(B)=m³-t³,then which of the following statement is true about G and H​...
  Math 3 29.09.2020 04:01
• Four paragraph essay on how covid 19 affects the mental health of people incorporate intensive and reflexive pronoun in your writing.​ english sub toh nalito lang HAHA...
  Technology and Home Economics 3 29.09.2020 04:01
• Short - term effects ofstimulants​...
  Health 2 29.09.2020 04:01
• Explain why having enough rest can promote overall health of our skin....
  Science 1 29.09.2020 04:01
• Marahil binibigyan ko lang nang katwiran ang kahihinatnan nga hindi ko pagbabalik aral ng leksiyon ​...
  Edukasyon sa Pagpapakatao 2 29.09.2020 04:01
• What are the negative lifestyles of people in your community that you frequently observed?...
  Science 3 29.09.2020 04:01
• Bumuo ng slogan na nagpapakiya ng kahalagahan ng kontemporaryong isyu.​...
  Araling Panlipunan 3 29.09.2020 04:01
• It is a receptacle for holding dirt, trash and other throw away​...
  Technology and Home Economics 3 29.09.2020 04:01
• Sa iyong palagay, ang klima ba ng Pilipinas ay tama lamang sa pang-araw-araw na pamumuhay ng mga tao? Bakit?...
  Araling Panlipunan 3 29.09.2020 04:01
• On the other parts that you identified why do you believe these part are involved in breathing?​...
  Science 1 29.09.2020 04:01
• Do you want to study Philosophy? Why?​...
  Religion 2 29.09.2020 04:01
• 1.)How many gallons of water are there in a 10 A x 5ft tank with 2 inches depth? (refer example on page 486) (3 points). 2.)How many gallons of water are there in 16.3 ftx 7 ft ta...
  Technology and Home Economics 2 29.09.2020 04:01
• Supply the missing term x² -? +49...
  Math 1 29.09.2020 04:01
• Explain the relevance of studying history particularly phillippine history...
  English 2 29.09.2020 04:01
• Kailan masasabi na ang pangngalan ay nasa kaukulang palagyo​???...
  Filipino 2 29.09.2020 04:01
• Explain the process of multiperspectivity...
  History 2 29.09.2020 04:01
• There's a lot of noise coming from the hallway. _ I close the window?...
  English 3 29.09.2020 04:01
• Panimulang pag-aaral o proposal, ito ay sa kabuuan ng ideyangbnabuo mula sa isang balangkas o framework.​...
  Filipino 3 29.09.2020 04:01
• Magbigay ng pangungusap na mula sa Alamat ng Sampaguita na nagpapakita na paraan ng paglalahad ng pananaw...
  Filipino 3 29.09.2020 04:01
• Ano kahalagahannglikasnayamansapang-araw-arawnapamumuhayng manoyaman ang mga rehiyon sa Asya?​...
  Araling Panlipunan 2 29.09.2020 04:01
• 9. The actual temperature of a tea is 78⁰C. Ben used a thermometer and measured the coffee’s temperature, the result is 83⁰C. What is percentage error of his measurement? *...
  Science 2 29.09.2020 04:01
• Ano sa palagay mo ang kalamangan at kawalan ng paggamit ng retorika sa panahon ng teknolohiya?...
  Filipino 1 29.09.2020 04:01
• How did the speaker describe the "YOU" in the poem?given as many description as possible​...
  Math 2 29.09.2020 04:01
• Short term effect of depressants​...
  Health 3 29.09.2020 04:01
• to avoid disruption to other student what should you use while watching a video tutorial on installing a system software​...
  Computer Science 2 29.09.2020 04:01
• Think of the characteristics of Jesus as a person. Use the letters of the name: "JESUS" in coming up with the characteristics of Jesus.J-E-S-U-S-please i need it now.​...
  Religion 2 29.09.2020 04:01
• 1. 2/6 + 2/4 =n? 2. 1 1/6 + 1/3=n? 3. 2/5 + 1/2=n? 4. 1 1/4 + 1 1/3=n? 5. 1/7 + 3/5=n? (without solution)...
  Math 3 29.09.2020 04:01
• Lokasyong insular ng brazil​...
  Araling Panlipunan 3 29.09.2020 04:01
• Best describes a scientest?​...
  Science 3 29.09.2020 04:01
• Paanomo ilalarawan ang iyong puso bilang isang mananampalataya? ipaliwanag ang iyong sagot​...
  Filipino 3 29.09.2020 04:01
• Ano ang pagkakatulad ng HAYOP AT TAO Ano ang pagkakaiba ng HAYOP AT TAO Paano kumilos ang HAYOP AT TAO...
  Edukasyon sa Pagpapakatao 2 29.09.2020 04:01
• How did the speaker describe the "YOU" in the poem?given as many description as possible​...
  English 2 29.09.2020 04:01
• In what way you can art in advertising the resiliency of the filipinos in facing hardship​...
  Art 2 29.09.2020 04:01
• Can; -soil mixed with water be identified? -aluminum mixed with water be identified? -newspaper mixed with water be identified? -softdrink inside a bottle identified? -rotten vege...
  Science 3 29.09.2020 04:01
• What are some common injuries that may happen during a sport officiating activity...
  Physical Education 3 29.09.2020 04:01
• PAANO NA IIMPLUWENSYAHAN NG PILOSOPIYA AT TEOLOHIYA ANG MGA PAGPAPASIYA NG TAO NA MAY KINALAMAN SA EKONOMIKS? MAGBIGAY NG KONKRETONG HALIMBAWA pleas hel​...
  Araling Panlipunan 3 29.09.2020 04:01
• Based on the financial statements of ABC business firm, the total sales of ABC reached 3,000,000.00. It also generated total investments of 2,000,000.00 and net income after taxes...
  Math 1 29.09.2020 04:01
• There willbe a music concert next to vienna coffee shop. would you like to go​...
  World Languages 1 29.09.2020 04:01
• Please make a letter for teachers day and make it nice...
  Religion 3 29.09.2020 04:01
• It is a receptacle for holding dirt, trash and other throw away​...
  Technology and Home Economics 2 29.09.2020 04:01
• An object is accelerated at a rate if 5m/s2.find the mass of the object if the force exerted on it is 4x10⁵ dynes​...
  Science 3 29.09.2020 04:01
• Ano ang ibig sabihin ng salitang masuyong...
  Filipino 1 29.09.2020 04:01
• Sino ang my akda na kwentong dalawang araw sa banyagang lupa?​...
  Filipino 3 29.09.2020 04:01

• 1
• 2
• 3
• Next